"}); "componentId" : "kudos.widget.button", Bu gerçekten garip ve tekrar öne geçmek zorundayım. "actions" : [ "event" : "MessagesWidgetEditAnswerForm", $('#vodafone-community-header .lia-search-input-wrapper').hide(); '; { LITHIUM.AjaxSupport.ComponentEvents.set({ var key = e.keyCode; } } $(this).removeClass('active'); $(document).ready(function(){ LITHIUM.Dialog({ "useSimpleView" : "false", "action" : "rerender" Although, I use a different model of pfSense along with the Ivacy VPN app and I don't think there is any extra shield needed because that's more than enough. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }, LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; { "displayStyle" : "horizontal", Well i have an ISP issued router: Fritz!Box 6490 Cable (germany) and i have a ton of Problems with port forwarding. .attr('aria-expanded','false'); Modems/Routers. }); "parameters" : { { } ] $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); element.siblings('li').find('ul').slideUp(); "actions" : [ { ;(function($) { "event" : "addMessageUserEmailSubscription", "parameters" : { "actions" : [ //}); "actions" : [ "action" : "addClassName" LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); Hello.I have an issue when I try to forward port TCP 3389, UDP 4500, UDP 500, UDP 1701, ESP. "event" : "removeThreadUserEmailSubscription", }, var clickedDomElement = $(this); I am convinced with his feedback. "context" : "envParam:quiltName", "messageViewOptions" : "1111110111111111111110111110100101001101" "context" : "envParam:quiltName,expandedQuiltName", { Box 7490 von AVM.Auch anwendbar auf andere FRITZ! "initiatorBinding" : true, Hier erkläre ich euch in einer kurzen Anleitung wie ihr Port forwarding bei einer Fritz!Box 6490 (Cable) konfiguriert. "action" : "rerender" with ipv6 every device have a public ip. } With an additional fiber optic modem, you can also use the FRITZ!Box on a fiber optic connection. I have a question about port forwarding with FRITZ!Box. var resetMenu = function() { { { "useSimpleView" : "false", } { "action" : "rerender" LITHIUM.Auth.CHECK_SESSION_TOKEN = 'e9Sd4WuLDg-ZzoqaUCHeG6cxEHvbSV6sU1WQg86WotA. "action" : "rerender" "actions" : [ "actions" : [ } "action" : "rerender" }, { "disallowZeroCount" : "false", LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; Port Forwarding for the FRITZ 6490 CableRouter Sceenshot Back to the FRITZ 6490 Cable FRITZ!Box 6490 Cable (kdg) FRITZ!Box 6490 Cable (kdg) FRITZ!Box 6490 Cable (kdg) The display is not possible with the version of the web browser used. "context" : "", } "disableLinks" : "false", /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ "action" : "pulsate" } "initiatorBinding" : true, }, Smart-Analyzer ‎10.07.2017 12:09. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); Networking: Port-Forwarding auf einer Fritz-Box einrichten. One or more of the LAN ports cannot be used to establish a connection to the FRITZ!Box. "truncateBody" : "true", count++; "event" : "MessagesWidgetMessageEdit", { if ( key == neededkeys[0] ) { ] { 876 Postings, noch 24 bis zum nächsten Level (900) Postings: 876. } { "context" : "", Select Other Applications in the drop down. "action" : "rerender" } "event" : "MessagesWidgetMessageEdit", "kudosLinksDisabled" : "false", { "actions" : [ ] { "action" : "rerender" "action" : "rerender" "actions" : [ $(this).toggleClass("view-btn-open view-btn-close"); ], "context" : "", ] { $(document).ready(function(){ } "disableLinks" : "false", "event" : "ProductAnswerComment", I have a question about port forwarding with FRITZ!Box. "actions" : [ }, "actions" : [ "truncateBodyRetainsHtml" : "false", } $('#node-menu li.has-sub>a').on('click', function(){ { } Recommended - Our free program will setup a static IP address for you. "actions" : [ }, "actions" : [ { 4 Fare clic sul pulsante "New Port Forwarding ". "action" : "rerender" }, "actions" : [ }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", var keycodes = { "accessibility" : false, "event" : "AcceptSolutionAction", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "actions" : [ { if ( watching ) { }); Clear editor. "context" : "", "context" : "envParam:quiltName,product,contextId,contextUrl", "context" : "", "initiatorDataMatcher" : "data-lia-kudos-id" $(document).ready(function(){ count = 0; { }, "entity" : "1612466", { LITHIUM.AjaxSupport.ComponentEvents.set({ { "event" : "kudoEntity", "context" : "", "forceSearchRequestParameterForBlurbBuilder" : "false", }, "event" : "MessagesWidgetEditCommentForm", }, { "includeRepliesModerationState" : "false", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); { //$('#vodafone-community-header .lia-search-input-wrapper').css('display','table-cell')} "action" : "rerender" "action" : "rerender" "action" : "rerender" "action" : "pulsate" "quiltName" : "ForumMessage", })(LITHIUM.jQuery); "context" : "envParam:entity", The IP protocols ESP and GRE are only required for VPN server services. { So I'm trying to port forward for my server, but it's not working. Here's the settings or whatever you'd call it (and yes, I've already applied it, it's just that that's the only way to view them); I'm pretty sure everything is correct, but I'm not 100% certain. { "useSubjectIcons" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetAnswerForm", { { ","loaderSelector":"#lineardisplaymessageviewwrapper .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); } Nähere Infos dazu findest Du im Eilmeldungsboard. 2. "quiltName" : "ForumMessage", LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); { } } "context" : "envParam:quiltName,message", $('.js-close-header-announcement').on('click', clickHandler); }, }, Simply select the router model from our list. } }, ] ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "removeThreadUserEmailSubscription", "actions" : [ "kudosLinksDisabled" : "false", "actions" : [ element.addClass('active'); } "actions" : [ }, "action" : "rerender" "context" : "", "event" : "addMessageUserEmailSubscription", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '8bMGJMPKgUqySO3qFuWMQZgCmH3WT74_V3AVi04W9qw. LITHIUM.AjaxSupport.ComponentEvents.set({ })(LITHIUM.jQuery); "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ "componentId" : "forums.widget.message-view", } "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hIEWwq_1_5kYo_UUopp2gDdLRrsqCoPPzwWeV8_zZN4. This firewall protects your home network by blocking incoming and outgoing connections that are not authorized. "context" : "", }, "context" : "envParam:quiltName,message,product,contextId,contextUrl", // --> "action" : "rerender" }, createStorage("true"); } "context" : "envParam:entity", It's really weird and I have to port forward again. { ] $(this).addClass('active') } { { LITHIUM.Loader.runJsAttached(); } { }, }, Click on the "Port Sharing" or "Port Forwarding" tab. Some online games or programs require additional connections to be opened so they can run smoothly. die Anwendung den Standard UPnP (Universal Plug and Play) oder PCP (Port Control Protocol) unterstützt. "action" : "rerender" { "action" : "rerender" "parameters" : { "action" : "pulsate" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper","componentSelector":"#lineardisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612420,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "actions" : [ var handleClose = function(event) { { } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "selector" : "#messageview_0", ] "actions" : [ ] "context" : "", "event" : "deleteMessage", { "selector" : "#messageview_1", "event" : "deleteMessage", { "}); count = 0; "accessibility" : false, ] "actions" : [ ] "}); } { } "eventActions" : [ count = 0; LITHIUM.UserListActual({"acceptedSolutionsColumnSelector":".UserList .lia-list-row .acceptedSolutionsCountColumn","kudosColumnSelector":".UserList .lia-list-row .kudosCountColumn"}); ] × "closeEvent" : "LITHIUM:lightboxCloseEvent", } "actions" : [ "; ] Mit nur wenigen Handgriffen haben Sie die Port-Weiterleitung in den Einstellungen der Fritzbox festgelegt: Öffnen Sie "fritz.box" in Ihrem Browser und melden Sie sich mit Ihren Daten im Router an. ] } "context" : "", "showCountOnly" : "false", }, - posted in Networking: Ive been trying too open three ports for hosting a small server. ] FRITZ BOX 7490 Router Open Port Guide. ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", var watching = false; }, "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_64d3e2a1863325', 'enableAutoComplete', '#ajaxfeedback_64d3e2a1863325_0', 'LITHIUM:ajaxError', {}, 'OEQH84ZC1Lbd5oai693QlHhG4Pikjm92Y3HkDkmmNyY. } "context" : "", }); ] "context" : "envParam:quiltName,message", }, ] "initiatorDataMatcher" : "data-lia-message-uid" It is important to setup a static ip addressin the device that you are forwarding a port to. ] } "action" : "rerender" LITHIUM.AjaxSupport.useTickets = false; }, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); "context" : "", "context" : "", LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_64d3e2a22816bc', 'disableAutoComplete', '#ajaxfeedback_64d3e2a1863325_0', 'LITHIUM:ajaxError', {}, 'PD-qm33r-FKsLeGdc4FRi1_rNFa_3T4sfQJBcdfRCNU. ] { } $(document).ready(function() { "message" : "1612466", "action" : "pulsate" "actions" : [ { { { "action" : "rerender" return; "context" : "envParam:feedbackData", { "actions" : [ Upload or insert images from URL. ;(function($) { Richten Sie die FRITZ!Box für automatische Portfreigaben ein, wenn . ","loaderSelector":"#lineardisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); var count = 0; "context" : "envParam:selectedMessage", "actions" : [ { } }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612466,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. Die meisten von Euch möchten wahrscheinlich den unbeliebten Status bei Online Games “NAT Typ Strikt” los werden. }, "closeEvent" : "LITHIUM:lightboxCloseEvent", ] "revokeMode" : "true", { "actions" : [ "displayStyle" : "horizontal", "event" : "QuickReply", { "event" : "MessagesWidgetEditCommentForm", "actions" : [ "initiatorBinding" : true, $(document).ready(function() { "kudosable" : "true", "dialogContentCssClass" : "lia-panel-dialog-content", { } "eventActions" : [ "action" : "rerender" } else { "defaultAriaLabel" : "", resetMenu(); "context" : "", { LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; $(this).toggleClass('active'); "actions" : [ } "action" : "rerender" "triggerSelector" : ".lia-panel-dialog-trigger-event-triggerDialogEvent", element.siblings('li').children('ul').slideUp(); "revokeMode" : "true", "actions" : [ LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1614426,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. je wilt dat de toepassing alle benodigde poorten zelfstandig in de FRITZ!Box configureert. In der FRITZ!Box ist für einen Webserver eine Freigabe von Port 80 an Port 80 eingerichtet und zusätzlich für ein NAS-System eine Freigabe von Port 81 an Port 80. })(LITHIUM.jQuery); ] ] { "event" : "ProductAnswerComment", "initiatorBinding" : true, "disableKudosForAnonUser" : "false", { "disableLabelLinks" : "false", I use a DynDNS, and a public IPv4. Click the New Port Forwarding button. "initiatorDataMatcher" : "data-lia-kudos-id" "action" : "rerender" "selector" : "#kudosButtonV2_0", LITHIUM.StarRating('#any_1', false, 1, 'LITHIUM:starRating'); .attr('aria-hidden','true') "action" : "rerender" "parameters" : { "disableKudosForAnonUser" : "false", $(event.data.selector).addClass('cssmenu-open') // console.log('watching: ' + key); }, //}); } { }); "accessibility" : false, By Shane C. of PcWinTech.com . "action" : "rerender" }, Der Zugriff über das Internet auf unterschiedliche Geräte im Heimnetz ist nicht möglich, wenn Pakete an den gleichen Port (Zielport) von der FRITZ!Box an verschiedene IP-Adressen im Heimnetz weitergeleitet werden sollen. "context" : "", Restoring Settings. "}); count = 0; .attr('aria-hidden','false') "event" : "markAsSpamWithoutRedirect", }, }); }, ] event.preventDefault(); "entity" : "1612420", The FRITZ BOX 7490 router has a firewall. } } "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", { LITHIUM.AjaxSupport.useTickets = false; LITHIUM.Cache.CustomEvent.set([{"elementId":"link_6","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612420}},{"elementId":"link_10","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1612466}},{"elementId":"link_14","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1614426}},{"elementId":"link_16","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1709798}},{"elementId":"link_17","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1692264}},{"elementId":"link_18","stopTriggerEvent":false,"fireEvent":"LITHIUM:selectMessage","triggerEvent":"click","eventContext":{"message":1682136}}]); Enable port forwarding for the AVM FRITZ!Box 7490. { "context" : "envParam:quiltName,message,product,contextId,contextUrl", "actions" : [ "selector" : "#messageview", }, Tobias Hartmann 15. }, } }, "disallowZeroCount" : "false", $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); $('.css-menu').removeClass('cssmenu-open') $('#node-menu li.has-sub>a').on('click', function(){ "context" : "envParam:quiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", Aim of this article: This article describes how to configure port forwarding on a Fritz!Box 3490 router. "actions" : [ ;(function($) { "actions" : [ Call of Duty oder die Chat-Funktion, muss die Spielekonsole jedoch für andere Teilnehmer aus dem Internet erreichbar sein. return; Why port forwarding feature is not working on my router? "dialogKey" : "dialogKey" } portforwarding niet is vereist voor een serverdienst. }, } })(LITHIUM.jQuery); } "message" : "1614426", }); } $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); ] "context" : "envParam:quiltName", { If you find a similar guide it will probably work just fine to get your ports open. "event" : "removeThreadUserEmailSubscription", "actions" : [ { lithadmin: [] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "context" : "envParam:selectedMessage", "useSimpleView" : "false", port sharing is not required for a server service. "actions" : [ "action" : "rerender" document.cookie=escape(cookieName) + "=" + cookieValue + ";domain=" + cookieDomain + ";path=/;expires=" + expireDate.toUTCString(); I have a problem. { "actions" : [ var element = $(this).parent('li'); watching = true; LITHIUM.InputEditForm("form_0", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Suche nach Benutzern läuft...","emptyText":"Keine Treffer","successText":"Gefundene Benutzer:","defaultText":"Benutzernamen oder Rang eingeben","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_64d3e2a1863325","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/ArchivKIP/thread-id/69870&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "dialogContentCssClass" : "lia-panel-dialog-content", ', 'ajax'); LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); ], "actions" : [ Click "Internet" in the FRITZ!Box user interface. "showCountOnly" : "false", { "context" : "lia-deleted-state", ] "actions" : [ LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); You can configure static port forwarding to allow other users in the Internet to access certain server services (e.g., HTTP server, remote maintenance server) or Internet applications (e.g., online games) in your FRITZ!Box home network. } "event" : "ProductMessageEdit", } } ] "action" : "rerender" "buttonDialogCloseAlt" : "Schließen", ] // We made it! "event" : "unapproveMessage", FRITZ! "event" : "MessagesWidgetEditAnswerForm", } "actions" : [ "event" : "unapproveMessage", $(this).toggleClass("view-btn-open view-btn-close"); "action" : "rerender" "actions" : [ "actions" : [ if ( neededkeys[count] == key ) { resetMenu(); "action" : "rerender" Port-Weiterleitung bei der Fritzbox aktivieren - das müssen Sie tun . "displayStyle" : "horizontal", "action" : "rerender" } "event" : "editProductMessage", LITHIUM.StarRating('#any_0', true, 2, 'LITHIUM:starRating'); "event" : "ProductAnswer", ] ] "messageViewOptions" : "1111110111111111111110111110100101011101" { "action" : "rerender" "actions" : [ LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_64d3e2a1863325","tooltipContentSelector":"#link_64d3e2a1863325_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_64d3e2a1863325_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "event" : "ProductAnswer", ] { "context" : "", { }, "event" : "AcceptSolutionAction", "useSubjectIcons" : "true", "action" : "rerender" LITHIUM.Tooltip({"bodySelector":"body#lia-body","delay":30,"enableOnClickForTrigger":false,"predelay":10,"triggerSelector":"#link_64d3e2a1863325","tooltipContentSelector":"#link_64d3e2a1863325_0-tooltip-element .content","position":["bottom","left"],"tooltipElementSelector":"#link_64d3e2a1863325_0-tooltip-element","events":{"def":"focus mouseover,blur mouseout"},"hideOnLeave":true}); "useSimpleView" : "false", "context" : "", Bist du sicher, dass du fortfahren möchtest? if ( count == neededkeys.length ) { ] "event" : "removeMessageUserEmailSubscription", { LITHIUM.Auth.CHECK_SESSION_TOKEN = 'e9Sd4WuLDg-ZzoqaUCHeG6cxEHvbSV6sU1WQg86WotA. ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1612466,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. var count = 0; "context" : "", 1.1. "action" : "rerender" "closeImageIconURL" : "https://forum.vodafone.de/skins/images/767B9E5D691D46035B0CB025156F3D71/responsive_peak/images/button_dialog_close.svg", "quiltName" : "ForumMessage", { "componentId" : "forums.widget.message-view", Do you have any additional questions? "context" : "", { "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); "}); "componentId" : "kudos.widget.button", } }, { }); }); } { { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/ArchivKIP/thread-id/69870","ajaxErrorEventName":"LITHIUM:ajaxError","token":"hIEWwq_1_5kYo_UUopp2gDdLRrsqCoPPzwWeV8_zZN4.